PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009130177.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 419aa    MW: 46393.1 Da    PI: 7.021
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009130177.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY612.48.5e-18713941386
         FLO_LFY   1 mdpeafsaslfkwd.praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksls 94 
                     mdpe f++ lf+w+ +ra++++pp  + +   ++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m+sls
  XP_009130177.1   1 MDPEGFTSGLFRWNpTRAMVQQPPPPVPPP-PQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLS 94 
                     9*************4455555566555544.4556666777888888899********************************************* PP

         FLO_LFY  95 eifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqe..ekeaagsggeglgeaelvaa 176
                     +ifr++llvGeryG+kaavraerrrl e  e+++++rr+l+      + +++aldalsqe    glseepv++  +++aag++g+g g +++ +a
  XP_009130177.1  95 HIFRWELLVGERYGVKAAVRAERRRLLEeeEQESSRRRHLIlsaagDSGTHHALDALSQEddwtGLSEEPVHQleHTDAAGNNGGGGGYWDAGQA 189
                     *************************976334445677777778844344556*******988889******996333366677777667766544 PP

         FLO_LFY 177 eekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge....erqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvq 267
                     +       kk +  +++++k++ + + e+d+d +e +d+d+ ++g +g     erqrehPfivtepgevargkknGLDYLf+LyeqCrefL+qvq
  XP_009130177.1 190 K------MKKPQ--QRRRKKQMVT-SVETDDDMNEGDDDDDGNGGGGGGvlgiERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQ 275
                     4......22222..2333333333.3344444444444444433333223555****************************************** PP

         FLO_LFY 268 kiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnah 362
                     +iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnah
  XP_009130177.1 276 TIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAH 370
                     *********************************************************************************************** PP

         FLO_LFY 363 prLsiWYvPtkLrqLChlerskas 386
                     prLsiWYvPtkLrqLChlers+a+
  XP_009130177.1 371 PRLSIWYVPTKLRQLCHLERSNAV 394
                     *********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.6E-1971393IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QQPPPPVPPP PQQQPPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGVK AAVRAERRRL  120
LEEEEQESSR RRHLILSAAG DSGTHHALDA LSQEDDWTGL SEEPVHQLEH TDAAGNNGGG  180
GGYWDAGQAK MKKPQQRRRK KQMVTSVETD DDMNEGDDDD DGNGGGGGGV LGIERQREHP  240
FIVTEPGEVA RGKKNGLDYL FHLYEQCREF LIQVQTIAKD RGEKCPTKVT NQVFRYAKKS  300
GASYINKPKM RHYVHCYALH CLDEEASNAL RRAFKERGEN VGSWRQACYK PLVNIACRHG  360
WDIDAVFNAH PRLSIWYVPT KLRQLCHLER SNAVAAASAL VGNGISCTGS SASGGLGFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1262314141183PROTEIN LEAFY
2vy2_A1e-1262314141183PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201PQQRRRKKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR1904360.0KR190436.1 Brassica rapa subsp. pekinensis leafy 2 (LFY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130177.10.0PREDICTED: protein LEAFY isoform X1
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLA0A0M3LBF60.0A0A0M3LBF6_BRARC; LEAFY
STRINGBra029305.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)